AOC2 (NM_009590) Human Recombinant Protein
CAT#: TP322991
Recombinant protein of human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2, 20 µg
View other "AOC2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222991 representing NM_009590
Red=Cloning site Green=Tags(s) MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLSREELTAVMRF LTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREALAIVLFGGQPQPNVSELVVG PLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPKAPIFLSSTFNYNGSTLAAVHATPR GLRSGDRATWMALYHNISGVGLFLHPVGLELLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRL EVVRVPLPPPNGASSLRSRNSPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQG ERIAYEVSVQECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALEGRVHATGYIN TAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDVVFKPVAAPWNPEHWLQRPQL TRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYRIQIHSPLGIHIPLESDMERALSWGRYQLVV TQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFL LRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 83.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033720 |
Locus ID | 314 |
UniProt ID | O75106 |
Refseq Size | 2681 |
Cytogenetics | 17q21.31 |
Refseq ORF | 2268 |
Synonyms | DAO2; RAO; SSAO |
Summary | Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. This gene shows high sequence similarity to copper amine oxidases from various species ranging from bacteria to mammals. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. This gene may be a candidate gene for hereditary ocular diseases. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | beta-Alanine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400465 | AOC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC416008 | AOC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400465 | Transient overexpression lysate of amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1 |
CNY 4840.00 |
|
LY416008 | Transient overexpression lysate of amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2 |
CNY 4840.00 |
|
PH322991 | AOC2 MS Standard C13 and N15-labeled recombinant protein (NP_033720) |
CNY 19520.00 |