MACROD2 (NM_080676) Human Recombinant Protein
CAT#: TP322689
Purified recombinant protein of Homo sapiens MACRO domain containing 2 (MACROD2), transcript variant 1, 20 µg
View other "MACROD2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222689 representing NM_080676
Red=Cloning site Green=Tags(s) MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKSLTE KVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNLNGCDTGHAKITCGYDLPAKY VIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYGFPNEPAAVIALNTIKEWLA KNHHEVDRIIFCVFLEVDFKIYKKKMNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDAD GVNTVTVPGPASEEAVEDCKDEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYM ETEELSSNQEDAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDAGAQDEAKEQ RNGTK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542407 |
| Locus ID | 140733 |
| UniProt ID | A1Z1Q3 |
| Refseq Size | 4863 |
| Cytogenetics | 20p12.1 |
| Refseq ORF | 1275 |
| Synonyms | C2orf133; C20orf133 |
| Summary | The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409100 | MACROD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409100 | Transient overexpression lysate of MACRO domain containing 2 (MACROD2), transcript variant 1 |
CNY 4840.00 |
|
| PH315636 | MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_001028259) |
CNY 19520.00 |
|
| PH322689 | MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_542407) |
CNY 14250.00 |
|
| TP315636 | Recombinant protein of human MACRO domain containing 2 (MACROD2), transcript variant 2, 20 µg |
CNY 2900.00 |
其它MACROD2产品
