TESC (NM_017899) Human Recombinant Protein
CAT#: TP322650
Recombinant protein of human tescalcin (TESC), 20 µg
View other "TESC" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222650 representing NM_017899
Red=Cloning site Green=Tags(s) MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNR NLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVE ELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETM ALCH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060369 |
Locus ID | 54997 |
UniProt ID | Q96BS2 |
Refseq Size | 1025 |
Cytogenetics | 12q24.22 |
Refseq ORF | 642 |
Synonyms | CHP3; TSC |
Summary | Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413481 | TESC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432652 | TESC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413481 | Transient overexpression lysate of tescalcin (TESC), transcript variant 1 |
CNY 3080.00 |
|
LY432652 | Transient overexpression lysate of tescalcin (TESC), transcript variant 2 |
CNY 3080.00 |
|
PH322650 | TESC MS Standard C13 and N15-labeled recombinant protein (NP_060369) |
CNY 14250.00 |