CALHM6 (NM_001010919) Human Recombinant Protein
CAT#: TP322648
Recombinant protein of human family with sequence similarity 26, member F (FAM26F), 20 µg
View other "CALHM6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222648 representing NM_001010919
Red=Cloning site Green=Tags(s) MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPALALFLLGYVL SARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLGGAFYECAATGSAAFAQRLCL GRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIFTSVTRCLSPVSFLQLKFW KIYLEQEQQILKSKATEHATELAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYV NRKEKTHSIRSTEGDTVIPVLGFVDSSGINSTPEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001010919 |
| Locus ID | 441168 |
| UniProt ID | Q5R3K3 |
| Refseq Size | 1109 |
| Cytogenetics | 6q22.1 |
| Refseq ORF | 945 |
| Synonyms | C6orf187; dJ93H18.5; FAM26F; INAM |
| Summary | Pore-forming subunit of a voltage-gated ion channel.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423229 | FAM26F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423229 | Transient overexpression lysate of family with sequence similarity 26, member F (FAM26F) |
CNY 3080.00 |
|
| PH322648 | FAM26F MS Standard C13 and N15-labeled recombinant protein (NP_001010919) |
CNY 19520.00 |
