USP16 (NM_006447) Human Recombinant Protein
CAT#: TP322609
Recombinant protein of human ubiquitin specific peptidase 16 (USP16), transcript variant 1, 20 µg
View other "USP16" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222609 representing NM_006447
Red=Cloning site Green=Tags(s) MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPS VWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRK QASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAV MQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKE LFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKS MPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGE VNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTRNLNGA YLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDE CSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRF QQAGFNLRKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANS HLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 93.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006438 |
| Locus ID | 10600 |
| UniProt ID | Q9Y5T5 |
| Refseq Size | 2989 |
| Cytogenetics | 21q21.3 |
| Refseq ORF | 2469 |
| Synonyms | UBP-M; UBPM |
| Summary | This gene encodes a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416633 | USP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422330 | USP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424308 | USP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416633 | Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 1 |
CNY 3080.00 |
|
| LY422330 | Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 3 |
CNY 4840.00 |
|
| LY424308 | Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 2 |
CNY 3080.00 |
|
| PH322609 | USP16 MS Standard C13 and N15-labeled recombinant protein (NP_006438) |
CNY 19520.00 |
|
| TP762091 | Purified recombinant protein of Human ubiquitin specific peptidase 16 (USP16), transcript variant 2,Met1-Asp355, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 1948.00 |
