DAP12 (TYROBP) (NM_003332) Human Recombinant Protein
CAT#: TP322502L
Recombinant protein of human TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 1, 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
货期*
                        4周
                    规格
                        
                         推荐一起购买 (2)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC222502 protein sequence 
Red=Cloning site Green=Tags(s) MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 9.3 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_003323 | 
| Locus ID | 7305 | 
| UniProt ID | O43914 | 
| Refseq Size | 608 | 
| Cytogenetics | 19q13.12 | 
| Refseq ORF | 339 | 
| Synonyms | DAP12; KARAP; PLOSL; PLOSL1 | 
| Summary | This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Mar 2010] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Natural killer cell mediated cytotoxicity | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        