ACRV1 (NM_020107) Human Recombinant Protein
CAT#: TP322483
Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 3, 20 µg
View other "ACRV1" proteins (17)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222483 representing NM_020107
Red=Cloning site Green=Tags(s) MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEPAATEHAEGEHTVGEQPSGEQPSGEHLS GEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAY MNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_064492 |
| Locus ID | 56 |
| UniProt ID | P26436 |
| Refseq Size | 1173 |
| Cytogenetics | 11q24.2 |
| Refseq ORF | 630 |
| Synonyms | D11S4365; SP-10; SPACA2 |
| Summary | This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402748 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412644 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412647 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412655 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419846 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402748 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 8 |
CNY 3080.00 |
|
| LY412644 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 3 |
CNY 3080.00 |
|
| LY412647 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 10 |
CNY 3080.00 |
|
| LY412655 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 2 |
CNY 3080.00 |
|
| LY419846 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 1 |
CNY 3080.00 |
|
| PH305185 | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_001603) |
CNY 19520.00 |
|
| PH313557 | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495) |
CNY 19520.00 |
|
| PH322483 | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064492) |
CNY 19520.00 |
|
| TP305185 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313557 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 10, 20 µg |
CNY 2900.00 |
|
| TP720355 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 1 |
CNY 1800.00 |
|
| TP761524 | Purified recombinant protein of Human acrosomal vesicle protein 1 (ACRV1), transcript variant 8, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
