Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Recombinant Protein
CAT#: TP322455
Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1, 20 µg
View other "Myelin oligodendrocyte glycoprotein" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222455 representing NM_206809
Red=Cloning site Green=Tags(s) MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.1 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_996532 |
| Locus ID | 4340 |
| UniProt ID | Q16653 |
| Refseq Size | 2119 |
| Cytogenetics | 6p22.1 |
| Refseq ORF | 741 |
| Synonyms | BTN6; BTNL11; MOGIG2; NRCLP7 |
| Summary | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404218 | MOG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404218 | Transient overexpression lysate of myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1 |
CNY 3080.00 |
|
| PH322455 | MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532) |
CNY 19520.00 |
|
| TP701232 | Purified recombinant protein of Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1, Gly30-Val155, with C-terminal His tag, expressed in HEK293 cells, 50ug |
CNY 7820.00 |
|
| TP720042 | Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3 |
CNY 1800.00 |
|
| TP724034 | Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG (C-His) |
CNY 3140.00 |
其它Myelin oligodendrocyte glycoprotein产品
