DOK3 (NM_024872) Human Recombinant Protein
CAT#: TP322370
Purified recombinant protein of Homo sapiens docking protein 3 (DOK3), transcript variant 1, 20 µg
View other "DOK3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222370 representing NM_024872
Red=Cloning site Green=Tags(s) MTRGARLRSDARAQLNQLSLDGGTGSGQKGKCEEFPSSLSSVSPGLEAAALLLAVTMDPLETPIKDGILY QQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRSAGPGRRGERRVIRLADCVSVLPAD GESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQLAFPGTGEASSGSTDAQSPKRGLVPMEENSIYSS WQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKLGSDKGVFSFEAGR RCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPCPLPRATSLPSLDTPGELREMPPGPEPP TSRKMHLAEPGPQSLPLLLGPEPNDLASGLYASVCKRASGPPGNEHLYENLCVLEASPTLHGGEPEPHEG PGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRERRKGP APCDRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 53.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079148 |
| Locus ID | 79930 |
| UniProt ID | Q7L591 |
| Refseq Size | 1762 |
| Cytogenetics | 5q35.3 |
| Refseq ORF | 1488 |
| Synonyms | DOKL |
| Summary | DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK3 is a negative regulator of JNK signaling in B-cells through interaction with INPP5D/SHIP1. May modulate ABL1 function (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411036 | DOK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428537 | DOK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411036 | Transient overexpression lysate of docking protein 3 (DOK3), transcript variant 1 |
CNY 4840.00 |
|
| LY428537 | Transient overexpression lysate of docking protein 3 (DOK3), transcript variant 3 |
CNY 3080.00 |
|
| PH322370 | DOK3 MS Standard C13 and N15-labeled recombinant protein (NP_079148) |
CNY 14250.00 |
