EXOC7 (NM_015219) Human Recombinant Protein
CAT#: TP322329
Recombinant protein of human exocyst complex component 7 (EXOC7), transcript variant 2, 20 µg
View other "EXOC7" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222329 representing NM_015219
Red=Cloning site Green=Tags(s) MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENL QRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVK LLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYG RNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGRDDMLDVETD AYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKAIVRHDFSTVLTV FPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHEL TSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNLLSKSKVYEDPAL SAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVFQPGV KLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNP EKYIKYGVEQVGDMIDRLFDTSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 74.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056034 |
| Locus ID | 23265 |
| UniProt ID | Q9UPT5 |
| Refseq Size | 4687 |
| Cytogenetics | 17q25.1 |
| Refseq ORF | 1959 |
| Synonyms | 2-5-3p; BLOM4; EX070; EXO70; Exo70p; EXOC1; NEDSEBA; YJL085W |
| Summary | The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Nov 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Insulin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC428802 | EXOC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428803 | EXOC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY428802 | Transient overexpression lysate of exocyst complex component 7 (EXOC7), transcript variant 5 |
CNY 4840.00 |
|
| LY428803 | Transient overexpression lysate of exocyst complex component 7 (EXOC7), transcript variant 6 |
CNY 4840.00 |
|
| PH322329 | EXOC7 MS Standard C13 and N15-labeled recombinant protein (NP_056034) |
CNY 19520.00 |
|
| PH327527 | EXOC7 MS Standard C13 and N15-labeled recombinant protein (NP_001138771) |
CNY 14250.00 |
|
| TP327527 | Purified recombinant protein of Homo sapiens exocyst complex component 7 (EXOC7), transcript variant 6, 20 µg |
CNY 2900.00 |
