Aminoadipate aminotransferase (AADAT) (NM_182662) Human Recombinant Protein
CAT#: TP322252
Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 2, 20 µg
View other "Aminoadipate aminotransferase" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222252 representing NM_182662
Red=Cloning site Green=Tags(s) MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL IKESL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_872603 |
| Locus ID | 51166 |
| UniProt ID | Q8N5Z0 |
| Refseq Size | 2108 |
| Cytogenetics | 4q33 |
| Refseq ORF | 1275 |
| Synonyms | KAT2; KATII; KYAT2 |
| Summary | This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
| Protein Pathways | Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405437 | AADAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC414111 | AADAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405437 | Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 2 |
CNY 4840.00 |
|
| LY414111 | Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 1 |
CNY 3080.00 |
|
| PH322252 | AADAT MS Standard C13 and N15-labeled recombinant protein (NP_872603) |
CNY 19520.00 |
|
| PH323277 | AADAT MS Standard C13 and N15-labeled recombinant protein (NP_057312) |
CNY 19520.00 |
|
| TP323277 | Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Aminoadipate aminotransferase产品
