POLR1F (NM_001002926) Human Recombinant Protein
CAT#: TP322203
Recombinant protein of human TWIST neighbor (TWISTNB), 20 µg
View other "POLR1F" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222203 protein sequence
Red=Cloning site Green=Tags(s) MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTG IREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSS SHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEV SEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKK KKKHQEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEAEFTPPLKCSPKRKGKSNFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002926 |
Locus ID | 221830 |
UniProt ID | Q3B726 |
Refseq Size | 3892 |
Cytogenetics | 7p21.1 |
Refseq ORF | 1014 |
Synonyms | A43; RPA43; TWISTNB |
Summary | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Through its association with RRN3/TIF-IA may be involved in recruitment of Pol I to rDNA promoters.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424120 | TWISTNB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424120 | Transient overexpression lysate of TWIST neighbor (TWISTNB) |
CNY 3080.00 |
|
PH322203 | TWISTNB MS Standard C13 and N15-labeled recombinant protein (NP_001002926) |
CNY 19520.00 |