Repulsive Guidance Molecule A (RGMA) (NM_020211) Human Recombinant Protein
CAT#: TP321996
Recombinant protein of human RGM domain family, member A (RGMA), 20 µg
View other "Repulsive Guidance Molecule A" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221996 representing NM_020211
Red=Cloning site Green=Tags(s) MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDL PGRAAAGLPLAPRPLLGALVPLLALLPVFCSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 49.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064596 |
Locus ID | 56963 |
UniProt ID | Q96B86 |
Refseq Size | 3216 |
Cytogenetics | 15q26.1 |
Refseq ORF | 1359 |
Synonyms | RGM |
Summary | This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein may also function as a tumor suppressor in some cancers. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402781 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC433077 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433079 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433119 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402781 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 4 |
CNY 4840.00 |
|
LY433077 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 3 |
CNY 3080.00 |
|
LY433079 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 2 |
CNY 3080.00 |
|
LY433119 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 1 |
CNY 3080.00 |
|
PH321996 | RGMA MS Standard C13 and N15-labeled recombinant protein (NP_064596) |
CNY 19520.00 |
|
TP721172 | Purified recombinant protein of Human RGM domain family, member A (RGMA), transcript variant 4 |
CNY 1800.00 |
其它Repulsive Guidance Molecule A产品