OVCA1 (DPH1) (NM_001383) Human Recombinant Protein
CAT#: TP321955
Recombinant protein of human DPH1 homolog (S. cerevisiae) (DPH1), 20 µg
View other "OVCA1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221955 representing NM_001383
Red=Cloning site Green=Tags(s) MRRQVMAALVVSGAAEQGGRDGPGRGRAPRGRVANQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQ QAQAKKVALQMPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGADFLVHYGHSCLIP MDTSAQDFRVLYVFVDIRIDTTHLLDSLRLTFPPATALALVSTIQFVSTLQAAAQELKAEYRVSVPQCKP LSPGEILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEA IATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVDVWVQVACPRL SIDWGTAFPKPLLTPYEAAVALRDISWQQPYPMDFYAGSSLGPWTVNHGQDRRPHAPGRPARGKVQEGSA RPPSAVACEDCSCRDEKVAPLAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001374 |
| Locus ID | 1801 |
| UniProt ID | Q9BZG8 |
| Refseq Size | 2200 |
| Cytogenetics | 17p13.3 |
| Refseq ORF | 1329 |
| Synonyms | DEDSSH; DPH2L; DPH2L1; OVCA1 |
| Summary | The protein encoded by this gene is an enzyme involved in the biosynthesis of diphthamide, a modified histidine found only in elongation factor-2 (EEF2). Diphthamide residues in EEF2 are targeted for ADP-ribosylation by diphtheria toxin and Pseudomonas exotoxin A. Defects in this gene have been associated with both ovarian cancer and autosomal recessive intellectual disability with short stature, craniofacial, and ectodermal anomalies. [provided by RefSeq, Oct 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419989 | DPH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY419989 | Transient overexpression lysate of DPH1 homolog (S. cerevisiae) (DPH1) |
CNY 4840.00 |
|
| PH321955 | DPH1 MS Standard C13 and N15-labeled recombinant protein (NP_001374) |
CNY 19520.00 |
