NEK11 (NM_024800) Human Recombinant Protein
CAT＃: TP321953
Recombinant protein of human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 20 µg
View other "NEK11" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221953 representing NM_024800
Red=Cloning site Green=Tags(s) MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNP NETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFI QLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYD TKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIE ILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKL QAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCVES DEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFN SVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQ LLITMGKEPTLQNHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 74 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079076 |
| Locus ID | 79858 |
| UniProt ID | Q8NG66 |
| Refseq Size | 2939 |
| Cytogenetics | 3q22.1 |
| Refseq ORF | 1935 |
| Summary | This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to genotoxic stress. Alternatively spliced transcript variants have been described.[provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407844 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC411057 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431511 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407844 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2 |
CNY 4840.00 |
|
| LY411057 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1 |
CNY 4840.00 |
|
| LY431511 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3 |
CNY 3080.00 |
|
| PH321953 | NEK11 MS Standard C13 and N15-labeled recombinant protein (NP_079076) |
CNY 19520.00 |
