LIN7 (LIN7A) (NM_004664) Human Recombinant Protein
CAT#: TP321902
Recombinant protein of human lin-7 homolog A (C. elegans) (LIN7A), 20 µg
View other "LIN7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221902 protein sequence
Red=Cloning site Green=Tags(s) MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ QQQLLIQQQQQQQQQQTQQNHMS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004655 |
Locus ID | 8825 |
UniProt ID | O14910 |
Refseq Size | 1235 |
Cytogenetics | 12q21.31 |
Refseq ORF | 699 |
Synonyms | LIN-7A; LIN7; MALS-1; MALS1; TIP-33; VELI1 |
Summary | The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a protein complex that couples synaptic vesicle exocytosis to cell adhesion in the brain. [provided by RefSeq, May 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417838 | LIN7A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417838 | Transient overexpression lysate of lin-7 homolog A (C. elegans) (LIN7A) |
CNY 3080.00 |
|
PH321902 | LIN7A MS Standard C13 and N15-labeled recombinant protein (NP_004655) |
CNY 19520.00 |