Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein
CAT#: TP321745
Recombinant protein of human pancreatic lipase-related protein 2 (PNLIPRP2), 20 µg
View other "Pancreatic Lipase Related Protein 2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221745 representing NM_005396
Red=Cloning site Green=Tags(s) MMLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQL ITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQN IRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVR LDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVS CNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTG ESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVK FLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 51.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005387 |
Locus ID | 5408 |
UniProt ID | P54317 |
Refseq Size | 1486 |
Cytogenetics | 10q25.3 |
Refseq ORF | 1410 |
Synonyms | PLRP2 |
Summary | This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided by RefSeq, Aug 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401656 | PNLIPRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401656 | Transient overexpression lysate of pancreatic lipase-related protein 2 (PNLIPRP2) |
CNY 4840.00 |
|
PH321745 | PNLIPRP2 MS Standard C13 and N15-labeled recombinant protein (NP_005387) |
CNY 19520.00 |
|
TP720758 | Purified recombinant protein of Human pancreatic lipase-related protein 2 (PNLIPRP2) |
CNY 1800.00 |
其它Pancreatic Lipase Related Protein 2产品