NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein
CAT#: TP321735
Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2, 20 µg
View other "NHP2L1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 6281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221735 protein sequence
Red=Cloning site Green=Tags(s) MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLP LLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001003796 |
| Locus ID | 4809 |
| UniProt ID | P55769 |
| Refseq Size | 1520 |
| Cytogenetics | 22q13.2 |
| Refseq ORF | 384 |
| Synonyms | 15.5K; FA-1; FA1; NHP2L1; NHPX; OTK27; SNRNP15-5; SPAG12; SSFA1 |
| Summary | Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417581 | NHP2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424011 | NHP2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417581 | Transient overexpression lysate of NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 1 |
CNY 3080.00 |
|
| LY424011 | Transient overexpression lysate of NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
CNY 3080.00 |
|
| PH321735 | NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003796) |
CNY 19520.00 |
|
| PH324143 | NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_004999) |
CNY 19520.00 |
|
| TP324143 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720213 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
CNY 1800.00 |
