MGC70863 (NM_203302) Human Recombinant Protein
CAT#: TP321712
Recombinant protein of human similar to RPL23AP7 protein (MGC70863), transcript variant 2, 20 µg
View other "MGC70863" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221712 representing NM_203302
Red=Cloning site Green=Tags(s) MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIEENNTLVFTVDVKANKHQIRQ AVKKLYDSDVAKVTTLICPDKENKAYVRLAPDYDAFDVVTKLGSPKLSPAG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_976047 |
Locus ID | 284942 |
Refseq Size | 1249 |
Cytogenetics | 22q13.33 |
Refseq ORF | 363 |
Synonyms | RPL23A_43_1761 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404241 | MGC70863 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404385 | MGC70863 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404241 | Transient overexpression lysate of similar to RPL23AP7 protein (MGC70863), transcript variant 1 |
CNY 3080.00 |
|
LY404385 | Transient overexpression lysate of similar to RPL23AP7 protein (MGC70863), transcript variant 2 |
CNY 3080.00 |
|
PH321712 | MGC70863 MS Standard C13 and N15-labeled recombinant protein (NP_976047) |
CNY 19520.00 |
其它MGC70863产品