TGIF2LY (NM_139214) Human Recombinant Protein
CAT#: TP321598
Recombinant protein of human TGFB-induced factor homeobox 2-like, Y-linked (TGIF2LY), 20 µg
View other "TGIF2LY" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221598 representing NM_139214
Red=Cloning site Green=Tags(s) MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMY KHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEA SVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_631960 |
Locus ID | 90655 |
UniProt ID | Q8IUE0 |
Refseq Size | 880 |
Cytogenetics | Yp11.2 |
Refseq ORF | 555 |
Synonyms | TGIFLY |
Summary | This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408358 | TGIF2LY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408358 | Transient overexpression lysate of TGFB-induced factor homeobox 2-like, Y-linked (TGIF2LY) |
CNY 3080.00 |
|
PH321598 | TGIF2LY MS Standard C13 and N15-labeled recombinant protein (NP_631960) |
CNY 14250.00 |
其它TGIF2LY产品