LUC7L (NM_201412) Human Recombinant Protein
CAT＃: TP321529
Recombinant protein of human LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2, 20 µg
View other "LUC7L" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221529 representing NM_201412
Red=Cloning site Green=Tags(s) MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR LESSNGKMASRRSEEKEAGEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_958815 |
| Locus ID | 55692 |
| UniProt ID | Q9NQ29 |
| Refseq Size | 1452 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 1113 |
| Synonyms | hLuc7B1; Luc7; LUC7B1; SR+89 |
| Summary | The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403707 | LUC7L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413372 | LUC7L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429566 | LUC7L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403707 | Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2 |
CNY 3080.00 |
|
| LY413372 | Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 |
CNY 3080.00 |
|
| LY429566 | Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 |
CNY 3080.00 |
|
| PH321529 | LUC7L MS Standard C13 and N15-labeled recombinant protein (NP_958815) |
CNY 19520.00 |
