OSBPL9 (NM_148907) Human Recombinant Protein
CAT#: TP321526
Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 4, 20 µg
View other "OSBPL9" proteins (19)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221526 representing NM_148907
Red=Cloning site Green=Tags(s) MAFLLATCGGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMV ESIKHCIVLLQIAKSTINPVDAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGH HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASV LTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTK VVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGE IFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFL GMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGG KKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWK DVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 70.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_683705 |
| Locus ID | 114883 |
| UniProt ID | Q96SU4 |
| Refseq Size | 2694 |
| Cytogenetics | 1p32.3 |
| Refseq ORF | 1878 |
| Synonyms | ORP-9; ORP9 |
| Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This family member functions as a cholesterol transfer protein that regulates Golgi structure and function. Multiple transcript variants, most of which encode distinct isoforms, have been identified. Related pseudogenes have been identified on chromosomes 3, 11 and 12. [provided by RefSeq, Jul 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407760 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407761 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407762 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407763 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407764 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407765 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY407760 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 1 |
CNY 3080.00 |
|
| LY407761 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 2 |
CNY 4840.00 |
|
| LY407762 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 3 |
CNY 4840.00 |
|
| LY407763 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 |
CNY 4840.00 |
|
| LY407764 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 |
CNY 4840.00 |
|
| LY407765 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 |
CNY 4840.00 |
|
| PH311520 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683707) |
CNY 19520.00 |
|
| PH321053 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683706) |
CNY 19520.00 |
|
| PH321526 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683705) |
CNY 19520.00 |
|
| TP311520 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 7, 20 µg |
CNY 2900.00 |
|
| TP321053 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP760439 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760538 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
