TIGIT (NM_173799) Human Recombinant Protein
CAT＃: TP321447
Recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), 20 µg
View other "TIGIT" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221447 protein sequence
Red=Cloning site Green=Tags(s) MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_776160 |
| Locus ID | 201633 |
| UniProt ID | Q495A1 |
| Refseq Size | 2978 |
| Cytogenetics | 3q13.31 |
| Refseq ORF | 732 |
| Synonyms | VSIG9; VSTM3; WUCAM |
| Summary | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.[provided by RefSeq, Sep 2009] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406575 | TIGIT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406575 | Transient overexpression lysate of T cell immunoreceptor with Ig and ITIM domains (TIGIT) |
CNY 3080.00 |
|
| PH321447 | TIGIT MS Standard C13 and N15-labeled recombinant protein (NP_776160) |
CNY 19520.00 |
|
| TP700214 | Purified recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP723994 | Human TIGIT Protein, hFc Tag |
CNY 5400.00 |
|
| TP724032 | Human TIGIT Protein, mFc Tag |
CNY 4925.00 |
|
| TP724033 | Human TIGIT Protein, His Tag |
CNY 4925.00 |
