FACL4 (ACSL4) (NM_022977) Human Recombinant Protein
CAT#: TP321413
Recombinant protein of human acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 2, 20 µg
View other "FACL4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221413 representing NM_022977
Red=Cloning site Green=Tags(s) MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAV IDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGS GLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLES KLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSG STGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSD QSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGA PLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFH PDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQK GVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHY LKDIERMYGGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 79 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_075266 |
| Locus ID | 2182 |
| UniProt ID | O60488 |
| Refseq Size | 5356 |
| Cytogenetics | Xq23 |
| Refseq ORF | 2133 |
| Synonyms | ACS4; FACL4; LACS4; MRX63; MRX68 |
| Summary | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the cognitive disability or Alport syndrome. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401417 | ACSL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411426 | ACSL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401417 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 1 |
CNY 3080.00 |
|
| LY411426 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 2 |
CNY 4840.00 |
|
| PH305356 | ACSL4 MS Standard C13 and N15-labeled recombinant protein (NP_004449) |
CNY 19520.00 |
|
| PH321413 | ACSL4 MS Standard C13 and N15-labeled recombinant protein (NP_075266) |
CNY 19520.00 |
|
| TP305356 | Recombinant protein of human acyl-CoA synthetase long-chain family member 4 (ACSL4), transcript variant 1, 20 µg |
CNY 2900.00 |
