MYADM (NM_001020818) Human Recombinant Protein
CAT#: TP321290
Purified recombinant protein of Human myeloid-associated differentiation marker (MYADM), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
View other "MYADM" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221290 representing NM_001020818
Red=Cloning site Green=Tags(s) MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKV myc-FLAG tag |
| Tag | Myc-DDK |
| Predicted MW | 35.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001018654 |
| Locus ID | 91663 |
| UniProt ID | Q96S97 |
| Refseq Size | 3243 |
| Cytogenetics | 19q13.42 |
| Refseq ORF | 966 |
| Synonyms | SB135 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408641 | MYADM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422676 | MYADM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422677 | MYADM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422678 | MYADM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422679 | MYADM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425436 | MYADM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408641 | Transient overexpression lysate of myeloid-associated differentiation marker (MYADM), transcript variant 2 |
CNY 3080.00 |
|
| LY422676 | Transient overexpression lysate of myeloid-associated differentiation marker (MYADM), transcript variant 1 |
CNY 3080.00 |
|
| LY422677 | Transient overexpression lysate of myeloid-associated differentiation marker (MYADM), transcript variant 3 |
CNY 3080.00 |
|
| LY422678 | Transient overexpression lysate of myeloid-associated differentiation marker (MYADM), transcript variant 4 |
CNY 3080.00 |
|
| LY422679 | Transient overexpression lysate of myeloid-associated differentiation marker (MYADM), transcript variant 5 |
CNY 3080.00 |
|
| LY425436 | Transient overexpression lysate of myeloid-associated differentiation marker (MYADM), transcript variant 3 |
CNY 3080.00 |
