ZGPAT (NM_181485) Human Recombinant Protein
CAT#: TP321260
Recombinant protein of human zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3, 20 µg
View other "ZGPAT" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221260 protein sequence
Red=Cloning site Green=Tags(s) MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKSRLLAALDEER PGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEEEEGEDEEELSGTKVSAPYYS SWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPF QDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDS DGTGDSSYARVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPR GKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNEKLQGQAPGALEAGAAPAGRR SKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVASAQLQEKLAGAQRQLGQLRA QEAGLQQEQRKADTHKKMTEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_852150 |
| Locus ID | 84619 |
| UniProt ID | Q8N5A5 |
| Refseq Size | 1898 |
| Cytogenetics | 20q13.33 |
| Refseq ORF | 1533 |
| Synonyms | GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP |
| Summary | Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405782 | ZGPAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410058 | ZGPAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY405782 | Transient overexpression lysate of zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3 |
CNY 3080.00 |
|
| LY410058 | Transient overexpression lysate of zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 1 |
CNY 4840.00 |
|
| PH321260 | ZGPAT MS Standard C13 and N15-labeled recombinant protein (NP_852150) |
CNY 19520.00 |
