APOA1BP (NAXE) (NM_144772) Human Recombinant Protein
CAT#: TP321119
Recombinant protein of human apolipoprotein A-I binding protein (APOA1BP), 20 µg
View other "APOA1BP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221119 protein sequence
Red=Cloning site Green=Tags(s) MSRLRALLGLGLLVAGSRLPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQ ELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTI YYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGL TVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPD TECVYRLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_658985 |
| Locus ID | 128240 |
| UniProt ID | Q8NCW5 |
| Refseq Size | 1121 |
| Cytogenetics | 1q22 |
| Refseq ORF | 864 |
| Synonyms | AIBP; APOA1BP; PEBEL; YJEFN1 |
| Summary | The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408111 | APOA1BP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408111 | Transient overexpression lysate of apolipoprotein A-I binding protein (APOA1BP) |
CNY 3080.00 |
|
| PH321119 | APOA1BP MS Standard C13 and N15-labeled recombinant protein (NP_658985) |
CNY 19520.00 |
其它APOA1BP产品
