SMN1 (NM_022874) Human Recombinant Protein
CAT#: TP321108
Recombinant protein of human survival of motor neuron 1, telomeric (SMN1), transcript variant b, 20 µg
View other "SMN1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221108 representing NM_022874
Red=Cloning site Green=Tags(s) MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTP KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSD LLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKI IPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_075012 |
| Locus ID | 6606 |
| UniProt ID | Q16637 |
| Refseq Size | 1525 |
| Cytogenetics | 5q13.2 |
| Refseq ORF | 786 |
| Synonyms | BCD541; GEMIN1; SMA; SMA1; SMA2; SMA3; SMA4; SMA@; SMN; SMNT; T-BCD541; TDRD16A |
| Summary | This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Multiple transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411525 | SMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424781 | SMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411525 | Transient overexpression lysate of survival of motor neuron 1, telomeric (SMN1), transcript variant b |
CNY 3080.00 |
|
| LY424781 | Transient overexpression lysate of survival of motor neuron 1, telomeric (SMN1), transcript variant d |
CNY 3080.00 |
|
| PH321108 | SMN1 MS Standard C13 and N15-labeled recombinant protein (NP_075012) |
CNY 19520.00 |
|
| PH321367 | SMN1 MS Standard C13 and N15-labeled recombinant protein (NP_000335) |
CNY 19520.00 |
|
| TP321367 | Recombinant protein of human survival of motor neuron 1, telomeric (SMN1), transcript variant d, 20 µg |
CNY 2900.00 |


