ZDHHC15 (NM_144969) Human Recombinant Protein
CAT#: TP321105
Recombinant protein of human zinc finger, DHHC-type containing 15 (ZDHHC15), 20 µg
View other "ZDHHC15" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221105 representing NM_144969
Red=Cloning site Green=Tags(s) MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTW TYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD RCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK FHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKF WLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_659406 |
| Locus ID | 158866 |
| UniProt ID | Q96MV8 |
| Refseq Size | 1782 |
| Cytogenetics | Xq13.3 |
| Refseq ORF | 1011 |
| Synonyms | DHHC15; MRX91 |
| Summary | The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Calponin-h2: a potential serum marker for the early detection of human breast cancer?
,null,
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine
,PubMed ID 25099617
[ZDHHC15]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403407 | ZDHHC15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431287 | ZDHHC15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403407 | Transient overexpression lysate of zinc finger, DHHC-type containing 15 (ZDHHC15), transcript variant 1 |
CNY 3080.00 |
|
| LY431287 | Transient overexpression lysate of zinc finger, DHHC-type containing 15 (ZDHHC15), transcript variant 2 |
CNY 3080.00 |
|
| PH321105 | ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406) |
CNY 19520.00 |
其它ZDHHC15产品
