APOBEC3A (NM_145699) Human Recombinant Protein
CAT#: TP320995
Purified recombinant protein of Homo sapiens apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A), 20 µg
View other "APOBEC3A" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC220995 protein sequence 
Red=Cloning site Green=Tags(s) MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRH AELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEAL QMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 22.8 kDa | 
| Concentration | >0.1 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_663745 | 
| Locus ID | 200315 | 
| UniProt ID | P31941 | 
| Refseq Size | 1349 | 
| Cytogenetics | 22q13.1 | 
| Refseq ORF | 597 | 
| Synonyms | A3A; ARP3; bK150C2.1; PHRBN | 
| Summary | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene lacks the zinc binding activity of other family members. The protein plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] | 
Citations (2)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                APOBEC3A regulates transcription from interferon-stimulated response elements
                                                ,null,
                                                Proceedings of the National Academy of Sciences of the United States of America
                                                ,PubMed ID 35549556
                                                [APOBEC3A]
                                                 | 
                                        
| 
                                                Apobec3A maintains HIV-1 latency through recruitment of epigenetic silencing machinery to the long terminal repeat
                                                ,Taura, M;Song, E;Ho, YC;Iwasaki, A;,
                                                Proc. Natl. Acad. Sci. U.S.A.
                                                ,PubMed ID 30670656
                                                [APOBEC3A]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC407901 | APOBEC3A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY407901 | Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A) | 
                                                     CNY 3080.00  | 
                                            |
| PH320995 | APOBEC3A MS Standard C13 and N15-labeled recombinant protein (NP_663745) | 
                                                     CNY 14250.00  | 
                                            
其它APOBEC3A产品
