Cyclin Y (CCNY) (NM_181698) Human Recombinant Protein
CAT#: TP320991
Recombinant protein of human cyclin Y (CCNY), transcript variant 2, 20 µg
View other "Cyclin Y" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220991 representing NM_181698
Red=Cloning site Green=Tags(s) MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_859049 |
| Locus ID | 219771 |
| UniProt ID | Q8ND76 |
| Refseq Size | 4735 |
| Cytogenetics | 10p11.21 |
| Refseq ORF | 1023 |
| Synonyms | C10orf9; CBCP1; CCNX; CFP1 |
| Summary | Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408148 | CCNY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408148 | Transient overexpression lysate of cyclin Y (CCNY), transcript variant 1 |
CNY 3080.00 |
|
| PH317807 | CCNY MS Standard C13 and N15-labeled recombinant protein (NP_659449) |
CNY 14250.00 |
|
| PH320991 | CCNY MS Standard C13 and N15-labeled recombinant protein (NP_859049) |
CNY 19520.00 |
|
| TP317807 | Purified recombinant protein of Homo sapiens cyclin Y (CCNY), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Cyclin Y产品
