NLRP3 (NM_004895) Human Recombinant Protein
CAT#: TP320952
Purified recombinant protein of Human NLR family, pyrin domain containing 3 (NLRP3), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
View other "NLRP3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220952 representing NM_004895
Red=Cloning site Green=Tags(s) MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAM AVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKY RKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFD PDDEHSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCC PDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITT RPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLR NHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTV LLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQIRLELLKWIEVKAKAKKLQIQPSQLEL FYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRH LDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGC NIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT SACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLST NQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNND LGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW myc-FLAG tag |
| Tag | Myc-DDK |
| Predicted MW | 118 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004886 |
| Locus ID | 114548 |
| UniProt ID | Q96P20 |
| Refseq Size | 4484 |
| Cytogenetics | 1q44 |
| Refseq ORF | 3108 |
| Synonyms | AGTAVPRL; AII; AVP; C1orf7; CIAS1; CLR1.1; DFNA34; FCAS; FCAS1; FCU; KEFH; MWS; NALP3; PYPAF1 |
| Summary | This gene encodes a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS) domain, and a leucine-rich repeat (LRR) motif. This protein interacts with the apoptosis-associated speck-like protein PYCARD/ASC, which contains a caspase recruitment domain, and is a member of the NLRP3 inflammasome complex. This complex functions as an upstream activator of NF-kappaB signaling, and it plays a role in the regulation of inflammation, the immune response, and apoptosis. The SARS-CoV 3a protein, a transmembrane pore-forming viroporin, has been shown to activate the NLRP3 inflammasome via the formation of ion channels in macrophages. Mutations in this gene are associated with familial cold autoinflammatory syndrome (FCAS), Muckle-Wells syndrome (MWS), chronic infantile neurological cutaneous and articular (CINCA) syndrome, neonatal-onset multisystem inflammatory disease (NOMID), keratoendotheliitis fugax hereditarian, and deafness, autosomal dominant 34, with or without inflammation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Alternative 5' UTR structures are suggested by available data; however, insufficient evidence is available to determine if all of the represented 5' UTR splice patterns are biologically valid. [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome |
| Protein Pathways | NOD-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401526 | NLRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421550 | NLRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426795 | NLRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401526 | Transient overexpression lysate of NLR family, pyrin domain containing 3 (NLRP3), transcript variant 1 |
CNY 4840.00 |
|
| LY421550 | Transient overexpression lysate of NLR family, pyrin domain containing 3 (NLRP3), transcript variant 3 |
CNY 4840.00 |
|
| LY426795 | Transient overexpression lysate of NLR family, pyrin domain containing 3 (NLRP3), transcript variant 4 |
CNY 4840.00 |
|
| TP750176 | Purified recombinant protein of Human NLR family, pyrin domain containing 3 (NLRP3), transcript variant 3, full length, with C-terminal HIS tag, expressed in E.Coli, 50 ug |
CNY 2040.00 |
|
| TP762656 | Purified recombinant protein of Human NLR family, pyrin domain containing 3 (NLRP3), transcript variant 4, full length, with N-GST and C-His tag, expressed in E.coli, 50ug |
CNY 2480.00 |

