ApoER2 (LRP8) (NM_017522) Human Recombinant Protein
CAT#: TP320903
Recombinant protein of human low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 3, 20 µg
View other "ApoER2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220903 representing NM_017522
Red=Cloning site Green=Tags(s) MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCIPSVWRCDEDD DCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHK CVPASWRCDGEKDCEGGADEAGCATSLGTCRGDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNE CLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDL LTKNCKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYM DKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDP LRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRK TLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDA CELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRDANEDSKMGSTVTAAVIGIIVPI VVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 74.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_059992 |
| Locus ID | 7804 |
| UniProt ID | Q14114 |
| Refseq Size | 6994 |
| Cytogenetics | 1p32.3 |
| Refseq ORF | 2100 |
| Synonyms | APOER2; HSZ75190; LRP-8; MCI1 |
| Summary | This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Lipid Peroxidation Induced ApoE Receptor-Ligand Disruption as a Unifying Hypothesis Underlying Sporadic Alzheimer’s Disease in Humans
,null,
Journal of Alzheimer's disease : JAD
,PubMed ID 35466940
[ApoER2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413735 | LRP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422708 | LRP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413735 | Transient overexpression lysate of low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 3 |
CNY 4840.00 |
|
| LY422708 | Transient overexpression lysate of low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 4 |
CNY 3080.00 |
|
| PH320903 | LRP8 MS Standard C13 and N15-labeled recombinant protein (NP_059992) |
CNY 19520.00 |
