GTPBP9 (OLA1) (NM_013341) Human Recombinant Protein
CAT#: TP320834
Recombinant protein of human Obg-like ATPase 1 (OLA1), transcript variant 1, 20 µg
View other "GTPBP9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220834 representing NM_013341
Red=Cloning site Green=Tags(s) MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDER FDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVD PIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKE IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQ KYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKY EDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037473 |
Locus ID | 29789 |
UniProt ID | Q9NTK5 |
Refseq Size | 4356 |
Cytogenetics | 2q31.1 |
Refseq ORF | 1188 |
Synonyms | DOC45; GBP45; GTBP9; GTPBP9; PTD004 |
Summary | This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22. [provided by RefSeq, Jun 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402245 | OLA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402245 | Transient overexpression lysate of Obg-like ATPase 1 (OLA1), transcript variant 1 |
CNY 3080.00 |
|
PH320834 | OLA1 MS Standard C13 and N15-labeled recombinant protein (NP_037473) |
CNY 19520.00 |