NF-kB p65 (RELA) (NM_021975) Human Recombinant Protein
CAT#: TP320780
Recombinant protein of human v-rel reticuloendotheliosis viral oncogene homolog A (avian) (RELA), transcript variant 1, 20 µg
View other "NF-kB p65" proteins (4)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
| Cited in 9 publications. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC220780 representing NM_021975 Red=Cloning site Green=Tags(s) MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG TVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP FQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD EIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL SEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTE PMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 60 kDa | 
| Concentration | >0.1 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | RELA Activity Verified in a DNA-binding Assay: RELA activity was measured in a colorimetric DNA-binding assay. Double-stranded oligonucleotide containing the RELA consensus DNA-binding sequence was incubated with dilutions of the purified RELA protein. RELA bound to the oligo was captured onto the surface of a microtiter plate and after washing, bound RELA was detected with an anti-RELA primary antibody followed by an HRP-labeled secondary antibody. After initial color development, the reaction was quenched and the color intensity was measured at 450nm. ELISA binding assay (PMID: 25584020) WB positive control (PMID: 25853889) EMSA assay (PMID: 25853889) Binding assay (PMID: 26561547) Pull-down assay (PMID: 26984196) | 
| Reference Data | |
| RefSeq | NP_068810 | 
| Locus ID | 5970 | 
| UniProt ID | Q04206 | 
| Refseq Size | 1760 | 
| Cytogenetics | 11q13.1 | 
| Refseq ORF | 1653 | 
| Synonyms | CMCU; NFKB3; p65 | 
| Summary | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] | 
| Protein Families | Druggable Genome, Transcription Factors | 
| Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway | 
Citations (9)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Highly efficient expression of circular RNA aptamers in cells using autocatalytic transcripts
                                                ,Litke, JL;Jaffrey, SR;,
                                                Nat. Biotechnol.
                                                ,PubMed ID 30962542
                                                [RELA] | 
| Detecting transcription factors with allosteric DNA-Silver nanocluster switches
                                                ,Li, B;Chen, Y;Wang, J;Lu, Q;Zhu, W;Luo, J;Hong, J;Zhou, X;,
                                                Analytica Chimica Acta
                                                
                                                [RELA] | 
| Novel Nuclear Factor-KappaB Targeting Peptide Suppresses β-Amyloid Induced Inflammatory and Apoptotic Responses in Neuronal Cells
                                                ,null,
                                                PLoS ONE
                                                ,PubMed ID 27764084
                                                [RELA] | 
| The M. tuberculosis HAD phosphatase (Rv3042c) interacts with host proteins and is inhibited by Clofazimine
                                                ,Shree, S;Singh, AK;Saxena, R;Kumar, H;,
                                                Cellular and Molecular Life Sciences
                                                ,PubMed ID 26984196
                                                [RELA] | 
| FOXO3-NF-?B RelA Protein Complexes Reduce Proinflammatory Cell Signaling and Function
                                                ,Thompson, MG;Larson, M;Vidrine, A;Barrios, K;Navarro, F;Meyers, K;Simms, P;Prajapati, K;Chitsike, L;Hellman, LM;Baker, BM;Watkins, SK;,
                                                J. Immunol.
                                                ,PubMed ID 26561547
                                                [RELA] | 
| MYB Elongation Is Regulated by the Nucleic Acid Binding of NF?B p50 to the Intronic Stem-Loop Region
                                                ,Pereira, LA;Hugo, HJ;Malaterre, J;Huiling, X;Sonza, S;Cures, A;Purcell, DF;Ramsland, PA;Gerondakis, S;Gonda, TJ;Ramsay, RG;,
                                                PLoS ONE
                                                ,PubMed ID 25853889
                                                [RELA] | 
| Functional characterization of a competitive peptide antagonist of p65 in human macrophage-like cells suggests therapeutic potential for chronic inflammation
                                                ,Srinivasan, M;Blackburn, C;Lahiri, D;,
                                                Drug Design, Development and Therapy
                                                ,PubMed ID 25584020
                                                [RELA] | 
| Novel p65 Binding Glucocorticoid-induced Leucine Zipper Peptide Suppresses Experimental Autoimmune Encephalomyelitis
                                                ,Mythily Srinivasan and Srihari Janardhanam,
                                                J. Biol. Chem., Dec 2011; 286: 44799 - 44810.
                                                
                                                [RELA] | 
| Novel p65 Binding Glucocorticoid-induced Leucine Zipper Peptide Suppresses Experimental Autoimmune Encephalomyelitis
                                                ,null,
                                                The Journal of Biological Chemistry
                                                ,PubMed ID 21965677
                                                [RELA] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402895 | RELA HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LY402895 | Transient overexpression lysate of v-rel reticuloendotheliosis viral oncogene homolog A (avian) (RELA), transcript variant 1 | CNY 4840.00 | |
| PH320780 | RELA MS Standard C13 and N15-labeled recombinant protein (NP_068810) | CNY 19520.00 | |
| TP750174 | Purified recombinant protein of Human v-rel reticuloendotheliosis viral oncogene homolog A (avian) (p65), transcript variant 1, Ser374-end, with C-terminal Myc-DDK tag, expressed in E.coli, 50ug | CNY 1948.00 | 
其它NF-kB p65产品


 
                         
                             
                             
                            

 
        