RIPPLY2 (NM_001009994) Human Recombinant Protein
CAT#: TP320725
Recombinant protein of human ripply2 homolog (zebrafish) (RIPPLY2), 20 µg
View other "RIPPLY2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220725 protein sequence
Red=Cloning site Green=Tags(s) MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASG KLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEDLTCEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009994 |
Locus ID | 134701 |
UniProt ID | Q5TAB7 |
Refseq Size | 674 |
Cytogenetics | 6q14.2 |
Refseq ORF | 384 |
Synonyms | C6orf159; dJ237I15.1; SCDO6 |
Summary | This gene encodes a nuclear protein that belongs to a novel family of proteins required for vertebrate somitogenesis. Members of this family have a tetrapeptide WRPW motif that is required for interaction with the transcriptional repressor Groucho and a carboxy-terminal Ripply homology domain/Bowline-DSCR-Ledgerline conserved region required for transcriptional repression. Null mutant mice die soon after birth and display defects in axial skeleton segmentation due to defective somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423172 | RIPPLY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423172 | Transient overexpression lysate of ripply2 homolog (zebrafish) (RIPPLY2) |
CNY 3080.00 |
|
PH320725 | RIPPLY2 MS Standard C13 and N15-labeled recombinant protein (NP_001009994) |
CNY 19520.00 |
其它RIPPLY2产品