MEF2C (NM_002397) Human Recombinant Protein
CAT#: TP320584
Recombinant protein of human myocyte enhancer factor 2C (MEF2C), transcript variant 1, 20 µg
View other "MEF2C" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220584 representing NM_002397
Red=Cloning site Green=Tags(s) MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002388 |
| Locus ID | 4208 |
| UniProt ID | Q06413 |
| Refseq Size | 4077 |
| Cytogenetics | 5q14.3 |
| Refseq ORF | 1419 |
| Synonyms | C5DELq14.3; DEL5q14.3 |
| Summary | This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010] |
| Protein Families | Transcription Factors |
| Protein Pathways | MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419349 | MEF2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434220 | MEF2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419349 | Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 1 |
CNY 3080.00 |
|
| LY434220 | Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 4 |
CNY 3080.00 |
|
| PH320584 | MEF2C MS Standard C13 and N15-labeled recombinant protein (NP_002388) |
CNY 19520.00 |


