MAPKAP Kinase 2 (MAPKAPK2) (NM_004759) Human Recombinant Protein
CAT#: TP320487
Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, 20 µg
View other "MAPKAP Kinase 2" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC220487 representing NM_004759 
Red=Cloning site Green=Tags(s) MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVL GLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMEC LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIR MGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE DVKGCLHDKNSDQATWLTRL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 42 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_004750 | 
| Locus ID | 9261 | 
| UniProt ID | P49137 | 
| Refseq Size | 3608 | 
| Cytogenetics | 1q32.1 | 
| Refseq ORF | 1110 | 
| Synonyms | MAPKAP-K2; MK-2; MK2 | 
| Summary | This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Protein Kinase | 
| Protein Pathways | MAPK signaling pathway, Neurotrophin signaling pathway, VEGF signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC409844 | MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC417772 | MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY409844 | Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY417772 | Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH308563 | MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_116584) | 
                                                     CNY 14250.00  | 
                                            |
| PH320487 | MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_004750) | 
                                                     CNY 19520.00  | 
                                            |
| TP308563 | Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它MAPKAP Kinase 2产品
