ANKS4B (NM_145865) Human Recombinant Protein
CAT#: TP320310
Recombinant protein of human ankyrin repeat and sterile alpha motif domain containing 4B (ANKS4B), 20 µg
View other "ANKS4B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220310 representing NM_145865
Red=Cloning site Green=Tags(s) MSTRYHQAASDSYLELLKEATKRDLNLSDEDGMTPTLLAAYHGNLEALEIICSRGGDPDRCDIWGNTPLH FAASNGHAHCVSFLVNFGANIFALDNDLQTPLDAAASREQNECVALLDKAATAQNIMNPKKVTRLKEQAQ KNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAPGTFGSLSKGIKDTFKIKFK KNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLGSIVFRRNR ISSPEDISDSKREFGFKLPSELLQRQGASEADEGAADEEGEENGLKDDLPWDDDEVEWEEDVVDATPLEV FLLSQHLEEFLPIFKREQIDLEALLLCSDEDLQSIQMQLGPRKKVLNAINRRKQVLQQPGQLVDTSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_665872 |
| Locus ID | 257629 |
| UniProt ID | Q8N8V4 |
| Refseq Size | 2906 |
| Cytogenetics | 16p12.2 |
| Refseq ORF | 1251 |
| Synonyms | HARP |
| Summary | As part of the intermicrovillar adhesion complex/IMAC plays a role in epithelial brush border differentiation, controlling microvilli organization and length. Plays a role in assembly of the complex (PubMed:26812018). May play a role in cellular response to endoplasmic reticulum stress (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407848 | ANKS4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY407848 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 4B (ANKS4B) |
CNY 4840.00 |
|
| PH320310 | ANKS4B MS Standard C13 and N15-labeled recombinant protein (NP_665872) |
CNY 19520.00 |
