CHRDL2 (NM_015424) Human Recombinant Protein
CAT#: TP320245
Recombinant protein of human chordin-like 2 (CHRDL2), 20 µg
View other "CHRDL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220245 representing NM_015424
Red=Cloning site Green=Tags(s) MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVS CYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVL CSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRG PGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILC TCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDN LRRFALEHEASDLVEIYLWKLVKDEETEAQRGEVPGPRPHSQNLPLDSDQESQEARLPERGTALPTARWP PRRSLERLPSPDPGAEGHGQSRQSDQDITKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Co-immunoprecipitation (PMID: 28009989) |
Reference Data | |
RefSeq | NP_056239 |
Locus ID | 25884 |
UniProt ID | Q6WN34 |
Refseq Size | 1699 |
Cytogenetics | 11q13.4 |
Refseq ORF | 1353 |
Synonyms | BNF1; CHL2 |
Summary | This gene encodes a member of the chordin family of proteins. Chordin family members are secreted proteins that share a cysteine-rich pro-collagen repeat domain and associate with members of the transforming growth factor beta superfamily. In vitro assays demonstrate a direct interaction between the encoded protein and human activin A. This gene is expressed in many tissues including osteoblasts, where it is differentially expressed during differentiation. In addition, its expression is upregulated in human osteoarthritic joint cartilage, suggesting a role in adult cartilage regeneration. [provided by RefSeq, Jan 2015] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Overexpression of colorectal cancer oncogene CHRDL2 predicts a poor prognosis
,Sun, J;Liu, X;Gao, H;Zhang, L;Ji, Q;Wang, Z;Zhou, L;Wang, Y;Sui, H;Fan, Z;Li, Q;,
Oncotarget
,PubMed ID 28009989
[CHRDL2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414584 | CHRDL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY414584 | Transient overexpression lysate of chordin-like 2 (CHRDL2) |
CNY 4,840.00 |
|
PH320245 | CHRDL2 MS Standard C13 and N15-labeled recombinant protein (NP_056239) |
CNY 19,520.00 |