TBL1Y (NM_033284) Human Recombinant Protein
CAT#: TP320139
Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 1, 20 µg
View other "TBL1Y" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220139 protein sequence
Red=Cloning site Green=Tags(s) MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDG TVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREA TVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNE NSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIF ALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDH PVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPN SSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY QGTGGIFEVCWNARGDKVGASASDGSVCVLDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_150600 |
Locus ID | 90665 |
UniProt ID | Q9BQ87 |
Refseq Size | 2407 |
Cytogenetics | Yp11.2 |
Refseq ORF | 1566 |
Synonyms | DFNY2; TBL1 |
Summary | The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This gene is highly similar to TBL1X gene in nucleotide sequence and protein sequence, but the TBL1X gene is located on chromosome X and this gene is on chromosome Y. This gene has three alternatively spliced transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408755 | TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC408756 | TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC409606 | TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY408755 | Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 2 |
CNY 4840.00 |
|
LY408756 | Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 3 |
CNY 4840.00 |
|
LY409606 | Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 1 |
CNY 4840.00 |
|
PH312240 | TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_599021) |
CNY 19520.00 |
|
PH314764 | TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_599020) |
CNY 19520.00 |
|
PH320139 | TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_150600) |
CNY 19520.00 |
|
TP312240 | Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP314764 | Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 2, 20 µg |
CNY 2900.00 |