PF4V1 (NM_002620) Human Recombinant Protein
CAT#: TP320116
Recombinant protein of human platelet factor 4 variant 1 (PF4V1), 20 µg
View other "PF4V1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220116 protein sequence
Red=Cloning site Green=Tags(s) MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002611 |
Locus ID | 5197 |
UniProt ID | P10720 |
Refseq Size | 741 |
Cytogenetics | 4q13.3 |
Refseq ORF | 312 |
Synonyms | CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1 |
Summary | The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and can protect against blood-retinal barrier breakdown in diabetes patients. [provided by RefSeq, Nov 2015] |
Protein Families | Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419209 | PF4V1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419209 | Transient overexpression lysate of platelet factor 4 variant 1 (PF4V1) |
CNY 3080.00 |
|
PH320116 | PF4V1 MS Standard C13 and N15-labeled recombinant protein (NP_002611) |
CNY 19520.00 |