PF4V1 (NM_002620) Human Recombinant Protein

CAT#: TP320116

Recombinant protein of human platelet factor 4 variant 1 (PF4V1), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "PF4V1" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00

CNY 6650.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Rabbit Polyclonal antibody to PF4V1 (platelet factor 4 variant 1)
    • 100 ul

CNY 6281.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC220116 protein sequence
Red=Cloning site Green=Tags(s)

MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC
PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002611
Locus ID 5197
UniProt ID P10720
Refseq Size 741
Cytogenetics 4q13.3
Refseq ORF 312
Synonyms CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Summary The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and can protect against blood-retinal barrier breakdown in diabetes patients. [provided by RefSeq, Nov 2015]
Protein Families Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...