Galectin 8 (LGALS8) (NM_006499) Human Recombinant Protein
CAT＃: TP320102
Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 1, 20 µg
View other "Galectin 8" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220102 representing NM_006499
Red=Cloning site Green=Tags(s) MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDSTVNH TLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKA FVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD IHLLEVRSW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006490 |
| Locus ID | 3964 |
| UniProt ID | O00214 |
| Refseq Size | 2996 |
| Cytogenetics | 1q43 |
| Refseq ORF | 1077 |
| Synonyms | Gal-8; PCTA-1; PCTA1; Po66-CBP |
| Summary | This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404450 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404451 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404452 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416600 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404450 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 2 |
CNY 3080.00 |
|
| LY404451 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 3 |
CNY 3080.00 |
|
| LY404452 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 4 |
CNY 3080.00 |
|
| LY416600 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 1 |
CNY 3080.00 |
|
| PH303752 | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963838) |
CNY 19520.00 |
|
| PH320102 | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_006490) |
CNY 14250.00 |
|
| PH320163 | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963837) |
CNY 19520.00 |
|
| TP303752 | Recombinant protein of human lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP320163 | Recombinant protein of human lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Galectin 8产品
