LPCAT1 (NM_024830) Human Recombinant Protein
CAT#: TP320083
Recombinant protein of human lysophosphatidylcholine acyltransferase 1 (LPCAT1), 20 µg
View other "LPCAT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220083 representing NM_024830
Red=Cloning site Green=Tags(s) MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWP LALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFD AIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGT CTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPS EEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEK DLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEY LYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079106 |
| Locus ID | 79888 |
| UniProt ID | Q8NF37 |
| Refseq Size | 3994 |
| Cytogenetics | 5p15.33 |
| Refseq ORF | 1602 |
| Synonyms | AGPAT9; AGPAT10; AYTL2; lpcat; LPCAT-1; lysoPAFAT; PFAAP3 |
| Summary | This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers. [provided by RefSeq, Sep 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403037 | LPCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403037 | Transient overexpression lysate of lysophosphatidylcholine acyltransferase 1 (LPCAT1) |
CNY 4840.00 |
|
| PH320083 | LPCAT1 MS Standard C13 and N15-labeled recombinant protein (NP_079106) |
CNY 19520.00 |


