NVL (NM_206840) Human Recombinant Protein
CAT#: TP319929
Recombinant protein of human nuclear VCP-like (NVL), transcript variant 2, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219929 representing NM_206840
Red=Cloning site Green=Tags(s) MEDYPDPQSANHMNSSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFID KTPSVKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVDGEIEAVL QKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAH AIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVA QLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEASRERILQTLCRKLRLPQA FDFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQD ELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMA ILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQV FQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILR PGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALR QEMARQKSGNEKGELKVSHKHFEEAFKKVRSSISKKDQIMYERLQESLSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 82.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_996671 |
| Locus ID | 4931 |
| UniProt ID | O15381 |
| Refseq Size | 2847 |
| Cytogenetics | 1q42.11 |
| Refseq ORF | 2250 |
| Synonyms | NVL2 |
| Summary | This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. Two encoded proteins, described as major and minor isoforms, have been localized to distinct regions of the nucleus. The largest encoded protein (major isoform) has been localized to the nucleolus and shown to participate in ribosome biosynthesis (PMID: 15469983, 16782053), while the minor isoform has been localized to the nucleoplasmin. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404238 | NVL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC419267 | NVL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY404238 | Transient overexpression lysate of nuclear VCP-like (NVL), transcript variant 2 |
CNY 4840.00 |
|
| LY419267 | Transient overexpression lysate of nuclear VCP-like (NVL), transcript variant 1 |
CNY 4840.00 |
|
| PH315387 | NVL MS Standard C13 and N15-labeled recombinant protein (NP_002524) |
CNY 14250.00 |
|
| PH319929 | NVL MS Standard C13 and N15-labeled recombinant protein (NP_996671) |
CNY 19520.00 |
|
| TP315387 | Recombinant protein of human nuclear VCP-like (NVL), transcript variant 1, 20 µg |
CNY 2900.00 |
