PRB1 (NM_199354) Human Recombinant Protein
CAT#: TP319911
Recombinant protein of human proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3, 20 µg
View other "PRB1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219911 representing NM_199354
Red=Cloning site Green=Tags(s) MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG PLPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNNPQ GPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_955386 |
Locus ID | 5542 |
UniProt ID | P04280 |
Refseq Size | 714 |
Cytogenetics | 12p13.2 |
Refseq ORF | 534 |
Synonyms | PM; PMF; PMS; PRB1L; PRB1M |
Summary | This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature peptides before secretion from the parotid glands. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Medium" allele. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404537 | PRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404537 | Transient overexpression lysate of proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3 |
CNY 3080.00 |
|
PH319911 | PRB1 MS Standard C13 and N15-labeled recombinant protein (NP_955386) |
CNY 19520.00 |