UNC119B (NM_001080533) Human Recombinant Protein
CAT#: TP319902
Recombinant protein of human unc-119 homolog B (C. elegans) (UNC119B), 20 µg
View other "UNC119B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219902 representing NM_001080533
Red=Cloning site Green=Tags(s) MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRP EHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFV RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQL SEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001074002 |
Locus ID | 84747 |
UniProt ID | A6NIH7 |
Refseq Size | 4811 |
Cytogenetics | 12q24.31 |
Refseq ORF | 753 |
Synonyms | POC7B |
Summary | Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated NPHP3 and plays a key role in localization of NPHP3 to the primary cilium membrane. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421088 | UNC119B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421088 | Transient overexpression lysate of unc-119 homolog B (C. elegans) (UNC119B) |
CNY 3080.00 |
|
PH319902 | UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002) |
CNY 14250.00 |
其它UNC119B产品