UQCRHL (NM_001089591) Human Recombinant Protein
CAT#: TP319881
Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL), 20 µg
View other "UQCRHL" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219881 representing NM_001089591
Red=Cloning site Green=Tags(s) MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE LFDFLHAKDHCVAHKLFNNLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001083060 |
| Locus ID | 440567 |
| UniProt ID | A0A096LP55 |
| Refseq Size | 538 |
| Cytogenetics | 1p36.21 |
| Refseq ORF | 273 |
| Summary | This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421339 | UQCRHL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421339 | Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL) |
CNY 3080.00 |
|
| PH319881 | UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060) |
CNY 19520.00 |
