GCOM1 (POLR2M) (NM_015532) Human Recombinant Protein
CAT#: TP319621
Recombinant protein of human glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A), transcript variant 1, 20 µg
View other "GCOM1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219621 representing NM_015532
Red=Cloning site Green=Tags(s) MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR KSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE ENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRR DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESS GRYREVRDEDDDWSSDEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | WB positive control (PMID: 26116512) |
| Reference Data | |
| RefSeq | NP_056347 |
| Locus ID | 81488 |
| UniProt ID | Q6EEV4 |
| Refseq Size | 4139 |
| Cytogenetics | 15q21.3 |
| Refseq ORF | 1104 |
| Synonyms | GCOM1; Gdown; Gdown1; GRINL1A |
| Summary | This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 4. Readthrough transcription between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein) is represented with GeneID 145781. [provided by RefSeq, Oct 2013] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Primary Central Nervous System (CNS) Lymphoma B Cell Receptors Recognize CNS Proteins
,Montesinos-Rongen, M;Purschke, FG;Brunn, A;May, C;Nordhoff, E;Marcus, K;Deckert, M;,
J. Immunol.
,PubMed ID 26116512
[POLR2M]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414481 | POLR2M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414481 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A), transcript variant 1 |
CNY 3080.00 |
|
| PH319621 | GRINL1A MS Standard C13 and N15-labeled recombinant protein (NP_056347) |
CNY 19520.00 |

