ODF3 (NM_053280) Human Recombinant Protein
CAT#: TP319533
Recombinant protein of human outer dense fiber of sperm tails 3 (ODF3), 20 µg
View other "ODF3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219533 protein sequence
Red=Cloning site Green=Tags(s) MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY NVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPA AYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPG DKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444510 |
Locus ID | 113746 |
UniProt ID | Q96PU9 |
Refseq Size | 1295 |
Cytogenetics | 11p15.5 |
Refseq ORF | 762 |
Synonyms | CT135; SHIPPO1; TISP50 |
Summary | ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement.[supplied by OMIM, Apr 2004] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409298 | ODF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409298 | Transient overexpression lysate of outer dense fiber of sperm tails 3 (ODF3) |
CNY 3,080.00 |
|
PH319533 | ODF3 MS Standard C13 and N15-labeled recombinant protein (NP_444510) |
CNY 19,520.00 |